PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G318700.1.p
Common NameKN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 406aa    MW: 46482.5 Da    PI: 6.2328
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G318700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.4e-093323672055
                        HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Aqcoe6G318700.1.p 332 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 367
                        4679*****************************885 PP

2ELK35.81.7e-12287308122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK++Ll+KYsgyL+sLkqE+s
  Aqcoe6G318700.1.p 287 ELKNHLLKKYSGYLSSLKQELS 308
                        9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-20142186IPR005540KNOX1
PfamPF037901.1E-21144185IPR005540KNOX1
SMARTSM012566.8E-27195246IPR005541KNOX2
PfamPF037912.5E-24199244IPR005541KNOX2
SMARTSM011881.0E-6287308IPR005539ELK domain
PfamPF037898.1E-10287308IPR005539ELK domain
PROSITE profilePS5121311.243287307IPR005539ELK domain
PROSITE profilePS5007113.038307370IPR001356Homeobox domain
SuperFamilySSF466891.5E-19308380IPR009057Homeodomain-like
SMARTSM003896.6E-13309374IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-27312372IPR009057Homeodomain-like
CDDcd000867.84E-12319371No hitNo description
PfamPF059201.6E-16327366IPR008422Homeobox KN domain
PROSITE patternPS000270345368IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MEDNYTPTTN NTRGSFLYCA PTPNVAPPNS TSSSSSLYGR NNNNNLEMNS FHIQSSNQQS  60
SFVKTEATQA AAGAASSSQH AGHQDFPYSL LSSADHHHQQ QQQQQQQHQQ QTINHFPLPH  120
QEQQDQGGER IGSRSFLFDN LDVIKAKIIT HPQYSNLLEA YMDCQKVGAP AEVVNRLTAV  180
RSEFETNQKA NLKMNYTSAH GDPELDQFME AYCDMLAKYR EELTRPLHEA MEFMRRIEEQ  240
LKSISNEPLH IFTDEKCDGL GSSEDDQDDS RGETEVPEID PRAEDRELKN HLLKKYSGYL  300
SSLKQELSKK KKKGKLPKEA RQKLLNWWEL HYKWPYPSET EKVALAESTG LDQKQINNWF  360
INQRKRHWKP SEDMQFVMME GLHPQNAGLY MDGHFMADGN YRLGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8543340.0KC854334.1 Aquilegia coerulea KN (KN) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245637.11e-160PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-148KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLS5MGZ40.0S5MGZ4_AQUCA; KN
STRINGVIT_18s0001g08380.t011e-158(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-121KNOTTED-like from Arabidopsis thaliana